"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5M7N2"	"{'domain_architectures': 5421, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'profile': 2, 'smart': 2, 'ssf': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5421}"	"['Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14)']"	"dusp23"	"[{'identifier': 'GO:0006470', 'name': 'protein dephosphorylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016311', 'name': 'dephosphorylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q5M7N2_XENTR"	"9ac91344c7a6273f0953acb6de9866e6d04df133"	True	False	False	132	"Dual specificity protein phosphatase 23"	2	"UP000008143"	"MAMPRLPAHYEYLCENGIRHLITLTEHKPPYHDTCPGITLHRIRILDFCAPSLEQIKNFLKIVDDAKAKGEAVGVHCLHGFGRTGTMLACYLVKVWKITGVDAINEIRSLRRGSIETTEQEKAIIQFHHHIK"	"unreviewed"	"{'taxId': '8364', 'scientificName': 'Xenopus tropicalis', 'fullName': 'Xenopus tropicalis (Western clawed frog)'}"
