General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5JIY5",
        "id": "SPT4_THEKO",
        "source_organism": {
            "taxId": "69014",
            "scientificName": "Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)",
            "fullName": "Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)"
        },
        "name": "Transcription elongation factor Spt4",
        "description": [
            "The Stp4-Spt5 complex stimulates transcription elongation on both naked DNA and histone-bound DNA (chromatin), facilitating transcription through the histone barrier (PubMed:30592095). Neither protein functions alone (PubMed:30592095). The complex also stimulates the transcription termination activity of FttA, neither protein alone stimulates FttA-dependent termination (PubMed:32094586)"
        ],
        "length": 67,
        "sequence": "MAKERACRHCHYITTEDRCPVCGSRDLSDDWFDLVIVLDVESRIAKKLRESIPEAAKVPGKYAIRVR",
        "proteome": "UP000000536",
        "gene": "spt4",
        "go_terms": [
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a1323d354c7d68f7a9ffaaba7fa34e66847fa219",
        "counters": {
            "domain_architectures": 5131,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5131
        }
    }
}