"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5JIY5"	"{'domain_architectures': 4379, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 2, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 2, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4379}"	"['The Stp4-Spt5 complex stimulates transcription elongation on both naked DNA and histone-bound DNA (chromatin), facilitating transcription through the histone barrier (PubMed:30592095). Neither protein functions alone (PubMed:30592095). The complex also stimulates the transcription termination activity of FttA, neither protein alone stimulates FttA-dependent termination (PubMed:32094586)']"	"spt4"	"[{'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"SPT4_THEKO"	"a1323d354c7d68f7a9ffaaba7fa34e66847fa219"	True	False	67	"Transcription elongation factor Spt4"	1	"UP000000536"	"MAKERACRHCHYITTEDRCPVCGSRDLSDDWFDLVIVLDVESRIAKKLRESIPEAAKVPGKYAIRVR"	"reviewed"	"{'taxId': '69014', 'scientificName': 'Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)', 'fullName': 'Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)'}"