General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5JCY8",
        "id": "ARCH_THEKO",
        "source_organism": {
            "taxId": "69014",
            "scientificName": "Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)",
            "fullName": "Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)"
        },
        "name": "Protein archease",
        "description": [
            "Activates the tRNA-splicing ligase complex by facilitating the enzymatic turnover of catalytic subunit RtcB. Acts by promoting the guanylylation of RtcB, a key intermediate step in tRNA ligation. Can also alter the NTP specificity of RtcB such that ATP, dGTP or ITP is used efficiently (By similarity)"
        ],
        "length": 142,
        "sequence": "MRKWEHYEHTADIGVRGYGSTLEEAFEAVALGLFDVMVNVKKVEPKECREVEVEEEDLEALLYSFLEELLVLHDMEGLVFGDVKVRIEKTENGYKLKAKACGEVLNPEKHEPKEEVKAITYHDMKIEKLPDGRWMAQFVPDL",
        "proteome": "UP000000536",
        "gene": "TK0361",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0aa81ee9ce9a63be34bb06770081b094fa6afd40",
        "counters": {
            "domain_architectures": 5269,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5269
        }
    }
}