"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5JCY8"	"{'domain_architectures': 5269, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5269}"	"['Activates the tRNA-splicing ligase complex by facilitating the enzymatic turnover of catalytic subunit RtcB. Acts by promoting the guanylylation of RtcB, a key intermediate step in tRNA ligation. Can also alter the NTP specificity of RtcB such that ATP, dGTP or ITP is used efficiently (By similarity)']"	"TK0361"	""	"ARCH_THEKO"	"0aa81ee9ce9a63be34bb06770081b094fa6afd40"	True	False	False	142	"Protein archease"	3	"UP000000536"	"MRKWEHYEHTADIGVRGYGSTLEEAFEAVALGLFDVMVNVKKVEPKECREVEVEEEDLEALLYSFLEELLVLHDMEGLVFGDVKVRIEKTENGYKLKAKACGEVLNPEKHEPKEEVKAITYHDMKIEKLPDGRWMAQFVPDL"	"reviewed"	"{'taxId': '69014', 'scientificName': 'Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)', 'fullName': 'Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)'}"