General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5EP17",
        "id": "PBGP9_SOLS1",
        "source_organism": {
            "taxId": "310431",
            "scientificName": "Solenopsis sp. (strain B0-178)",
            "fullName": "Solenopsis sp. (strain B0-178) (Fire ant)"
        },
        "name": "Pheromone-binding protein Gp-9",
        "description": [
            "Colony queen number, a major feature of social organization, is associated with worker genotype for Gp-9. Colonies are headed by either a single reproductive queen (monogyne form) or multiple queens (polygyne form). Differences in worker Gp-9 genotypes between social forms may cause differences in workers' abilities to recognize queens and regulate their numbers (By similarity)"
        ],
        "length": 153,
        "sequence": "MKTLVFHIFIFALVAFASASRNSAKKIGSQYDHYQTCLTELGVTEDDLFSIGEVTSGQHKTKHEDTKLHRNGCVMQCLLEKAGLMTGADFDEEKMRENYIEEKGLQPGDQRIDFLNSCMEQTKDIEDKCDKSLIFIGCVLMNEVSLPASNEEA",
        "proteome": null,
        "gene": "Gp-9",
        "go_terms": [
            {
                "identifier": "GO:0005549",
                "name": "odorant binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035176",
                "name": "social behavior",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "938d961b24b3606b31a783edcb45f0ff07ef5ac7",
        "counters": {
            "domain_architectures": 13013,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13013
        }
    }
}