"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5EP17"	"{'domain_architectures': 13013, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13013}"	"[""Colony queen number, a major feature of social organization, is associated with worker genotype for Gp-9. Colonies are headed by either a single reproductive queen (monogyne form) or multiple queens (polygyne form). Differences in worker Gp-9 genotypes between social forms may cause differences in workers' abilities to recognize queens and regulate their numbers (By similarity)""]"	"Gp-9"	"[{'identifier': 'GO:0005549', 'name': 'odorant binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0035176', 'name': 'social behavior', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005615', 'name': 'extracellular space', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PBGP9_SOLS1"	"938d961b24b3606b31a783edcb45f0ff07ef5ac7"	True	False	False	153	"Pheromone-binding protein Gp-9"	3	""	"MKTLVFHIFIFALVAFASASRNSAKKIGSQYDHYQTCLTELGVTEDDLFSIGEVTSGQHKTKHEDTKLHRNGCVMQCLLEKAGLMTGADFDEEKMRENYIEEKGLQPGDQRIDFLNSCMEQTKDIEDKCDKSLIFIGCVLMNEVSLPASNEEA"	"reviewed"	"{'taxId': '310431', 'scientificName': 'Solenopsis sp. (strain B0-178)', 'fullName': 'Solenopsis sp. (strain B0-178) (Fire ant)'}"