General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5EE07",
        "id": "DID_ECHCA",
        "source_organism": {
            "taxId": "40353",
            "scientificName": "Echis carinatus",
            "fullName": "Echis carinatus (Saw-scaled viper)"
        },
        "name": "Disintegrin",
        "description": [
            "Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1)"
        ],
        "length": 64,
        "sequence": "NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLHDYCTGVTSDCPRNRYNH",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b30dbf931bc20efa7c46e26a9df409d4fcbe9c86",
        "counters": {
            "domain_architectures": 373,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 373
        }
    }
}