"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5EE07"	"{'domain_architectures': 373, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 373}"	"['Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1)']"	""	""	"DID_ECHCA"	"b30dbf931bc20efa7c46e26a9df409d4fcbe9c86"	True	False	True	64	"Disintegrin"	1	""	"NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLHDYCTGVTSDCPRNRYNH"	"reviewed"	"{'taxId': '40353', 'scientificName': 'Echis carinatus', 'fullName': 'Echis carinatus (Saw-scaled viper)'}"