HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5E2R2",
"id": "COAE_ALIF1",
"source_organism": {
"taxId": "312309",
"scientificName": "Aliivibrio fischeri (strain ATCC 700601 / ES114)",
"fullName": "Aliivibrio fischeri (strain ATCC 700601 / ES114)"
},
"name": "Dephospho-CoA kinase",
"description": [
"Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A"
],
"length": 182,
"sequence": "MSYVVAITGGIGSGKTTVADRFQALYNINIVDADIIAREVVNPGTEGLIQIEQHFGPQILLDDGHLNRAKLRECIFSEPSEKQWLNDLLHPLIRSEMQRQIALSTSEYTLLVVPLLVENKLQYLANRVLVVDVLEQTQINRTVNRDKVNHQQVKAILASQASREERLAAADDIINNDHKIMT",
"proteome": "UP000000537",
"gene": "coaE",
"go_terms": [
{
"identifier": "GO:0004140",
"name": "dephospho-CoA kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015937",
"name": "coenzyme A biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "49638b9f42bbff824978a79f98cc7886acc4d639",
"counters": {
"domain_architectures": 28647,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"profile": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28647
}
}
}