"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5E2R2"	"{'domain_architectures': 28647, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'profile': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28647}"	"[""Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A""]"	"coaE"	"[{'identifier': 'GO:0004140', 'name': 'dephospho-CoA kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015937', 'name': 'coenzyme A biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"COAE_ALIF1"	"49638b9f42bbff824978a79f98cc7886acc4d639"	True	False	False	182	"Dephospho-CoA kinase"	3	"UP000000537"	"MSYVVAITGGIGSGKTTVADRFQALYNINIVDADIIAREVVNPGTEGLIQIEQHFGPQILLDDGHLNRAKLRECIFSEPSEKQWLNDLLHPLIRSEMQRQIALSTSEYTLLVVPLLVENKLQYLANRVLVVDVLEQTQINRTVNRDKVNHQQVKAILASQASREERLAAADDIINNDHKIMT"	"reviewed"	"{'taxId': '312309', 'scientificName': 'Aliivibrio fischeri (strain ATCC 700601 / ES114)', 'fullName': 'Aliivibrio fischeri (strain ATCC 700601 / ES114)'}"
