General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5A5Q6",
        "id": "ASH1_CANAL",
        "source_organism": {
            "taxId": "237561",
            "scientificName": "Candida albicans (strain SC5314 / ATCC MYA-2876)",
            "fullName": "Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)"
        },
        "name": "Transcriptional regulatory protein ASH1",
        "description": [
            "Component of the RPD3C(L) histone deacetylase complex (HDAC). Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events (By similarity). Controls filamentous growth and required for full virulence in a mouse model of disseminated candidiasis"
        ],
        "length": 449,
        "sequence": "MSLVQSAMFNHHMGPSHTRSRSFELFQEAKTLRVAACKRSYSDDLNISTKRARTAPPSPPYETATPTRASRLVISNLVKPTSNLRSRSLSPNKKFSSPLSPSSSPIATVTSPISSPQNIKIKLPSISDALNLPPITSKEPVKLKPIVPTVSLDYFDTYKPNDENWRYGLLDKIAKESKHFHLNQYNYLNDHAKPSFDSKLSSKIQQSSIANGKKINFPYESNYTYLNKTYLNDVKNYPEYLELAAESLLQLKERQLPPPPLQSHQKQHPPPPPHLPVQGLLPVPAPPVSHFSSSYTTPQAPTFYHPPSQQQQQTPPPQTLHHQQPQPPISTHKFIPISPPSAKKSRSDLLKSPPKHHHHHAPRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLRYKKTKARCLNDKCKKIPAKGEWTLMQSKGKETFEDGIEGYSCIACGWRVEVLPKS",
        "proteome": "UP000000559",
        "gene": "ASH1",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3e4e9e6a0662cb18564193c584fc8c907508990e",
        "counters": {
            "domain_architectures": 21748,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21748
        }
    }
}