General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q58T64",
        "id": "M3112_BOMMX",
        "source_organism": {
            "taxId": "161274",
            "scientificName": "Bombina maxima",
            "fullName": "Bombina maxima (Giant fire-bellied toad)"
        },
        "name": "Maximins 3/H11 type 2",
        "description": [
            "Maximin-3 shows antibacterial activity against both Gram-positive and Gram-negative bacteria. It also shows antimicrobial activity against the fungus C.albicans, but not against A.flavus nor P.uticale. It has little hemolytic activity. It possess a significant cytotoxicity against tumor cell lines. It possess a significant anti-HIV activity. It shows high spermicidal activity",
            "Maximin-H11 shows antimicrobial activity against bacteria and against the fungus C.albicans. Shows strong hemolytic activity (By similarity)"
        ],
        "length": 144,
        "sequence": "MHFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLREIRGIGGKILSGLKTALKGAAKELASTYLHRKRTAEEHEVMKRLEAIMRDLDSLDYPEEASERETRGFNQDKIANLFTKKEKRILGPVLGLVGSALGGLIKKIG",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0042742",
                "name": "defense response to bacterium",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3d60f9ec2d8790d0d5907e5cf6491e6b355c228a",
        "counters": {
            "domain_architectures": 233,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 233
        }
    }
}