"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q58T64"	"{'domain_architectures': 233, 'entries': 2, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 233}"	"['Maximin-3 shows antibacterial activity against both Gram-positive and Gram-negative bacteria. It also shows antimicrobial activity against the fungus C.albicans, but not against A.flavus nor P.uticale. It has little hemolytic activity. It possess a significant cytotoxicity against tumor cell lines. It possess a significant anti-HIV activity. It shows high spermicidal activity', 'Maximin-H11 shows antimicrobial activity against bacteria and against the fungus C.albicans. Shows strong hemolytic activity (By similarity)']"	""	"[{'identifier': 'GO:0042742', 'name': 'defense response to bacterium', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"M3112_BOMMX"	"3d60f9ec2d8790d0d5907e5cf6491e6b355c228a"	True	False	False	144	"Maximins 3/H11 type 2"	1	""	"MHFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLREIRGIGGKILSGLKTALKGAAKELASTYLHRKRTAEEHEVMKRLEAIMRDLDSLDYPEEASERETRGFNQDKIANLFTKKEKRILGPVLGLVGSALGGLIKKIG"	"reviewed"	"{'taxId': '161274', 'scientificName': 'Bombina maxima', 'fullName': 'Bombina maxima (Giant fire-bellied toad)'}"