GET /api/protein/UniProt/Q54823/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q54823",
        "id": "DNRQ_STRPE",
        "source_organism": {
            "taxId": "1950",
            "scientificName": "Streptomyces peucetius",
            "fullName": "Streptomyces peucetius"
        },
        "name": "Anthracycline biosynthesis protein DnrQ",
        "description": [
            "Involved in the biosynthesis of the anthracyclines carminomycin and daunorubicin (daunomycin) which are aromatic polyketide antibiotics that exhibit high cytotoxicity and are widely applied in the chemotherapy of a variety of cancers. DnrQ is required for the glycosylation of epsilon-rhodomycinone by DnrS to yield rhodomycin D"
        ],
        "length": 438,
        "sequence": "MPTPTSAPPAAPTDSELGRHLLTVRGFHFVFGALGDPYARRLRGEADHLSLGELVRDRGPLHGSALGTWVTADGGISARLLDDPLLGPRHPASEGPQEHVLENVWETWRTCHVTPLGEDLLTPAAADSDRLAALLGPVLGPRTCTAWQVDAGRAVHRVLDGLPPHFDVVSDLARPAIAGSLAAVLGLPDEARAELPDLLAACGPVLDSALCPPRLPVARAMTQALRRVRELMAAAVANHLTAPADGAVSALLAVDPGGGRDPGDTVTAAVLSTVVGAETAITTVANAVMALLKHDEQWSLLRADPGRAADAVEETLRWAPPVTLRSLITQGEVQIGGETLEADQHVVVLVDAAQRDPALYEDPDRFRLDRPRSPGFTHMALAGRDHLGLVAPLVRVQCTAVLRALAERLPGLRAEGEPLRRGRSPVVRAPLSLRLAQK",
        "proteome": null,
        "gene": "dnrQ",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a02e61ba6c64bb9a9c779746e03a6c43264a16fb",
        "counters": {
            "domain_architectures": 520850,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 520850
        }
    }
}