GET /api/protein/UniProt/Q4WTA7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4WTA7",
        "id": "Q4WTA7_ASPFU",
        "source_organism": {
            "taxId": "330879",
            "scientificName": "Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)",
            "fullName": "Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)"
        },
        "name": "Kynurenine formamidase",
        "description": [
            "Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites"
        ],
        "length": 295,
        "sequence": "MPTETLRYGDHKLQTVTISTVSDNLNAGYWVILIHGGAWRDPTQTAASYVAPAESILTTSPTYTSTTLPHIAAFASIEYRLSAHPSYPQNPDHLDSTEYRNAKHPDHIRDVQAALALLQRKYGFGSKYILVGHSAGATLAFQSVMGTFRDSAAAVASPPVAILGMAGIYDLRLLRDTHRDISAYQEFIEGAFGSDEAVWDAASPAFVKGSQGVEGGWTSGRLAVLAHSAEDGLVDAAQQKAMQAALSRWEDNTPQGSGQRRVEMLSLKDDHDDAWMKGDELARAIAHTLAELQKQ",
        "proteome": "UP000002530",
        "gene": "AFUA_1G09960",
        "go_terms": [
            {
                "identifier": "GO:0004061",
                "name": "arylformamidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019441",
                "name": "L-tryptophan catabolic process to L-kynurenine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}