"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4WTA7"	"{'domain_architectures': 0, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1}"	"['Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites']"	"AFUA_1G09960"	"[{'identifier': 'GO:0004061', 'name': 'arylformamidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019441', 'name': 'L-tryptophan catabolic process to L-kynurenine', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q4WTA7_ASPFU"	""	True	False	False	295	"Kynurenine formamidase"	3	"UP000002530"	"MPTETLRYGDHKLQTVTISTVSDNLNAGYWVILIHGGAWRDPTQTAASYVAPAESILTTSPTYTSTTLPHIAAFASIEYRLSAHPSYPQNPDHLDSTEYRNAKHPDHIRDVQAALALLQRKYGFGSKYILVGHSAGATLAFQSVMGTFRDSAAAVASPPVAILGMAGIYDLRLLRDTHRDISAYQEFIEGAFGSDEAVWDAASPAFVKGSQGVEGGWTSGRLAVLAHSAEDGLVDAAQQKAMQAALSRWEDNTPQGSGQRRVEMLSLKDDHDDAWMKGDELARAIAHTLAELQKQ"	"unreviewed"	"{'taxId': '330879', 'scientificName': 'Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)', 'fullName': 'Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)'}"