GET /api/protein/UniProt/Q4R3M6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4R3M6",
        "id": "NDUS5_MACFA",
        "source_organism": {
            "taxId": "9541",
            "scientificName": "Macaca fascicularis",
            "fullName": "Macaca fascicularis (Crab-eating macaque)"
        },
        "name": "NADH dehydrogenase [ubiquinone] iron-sulfur protein 5",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 106,
        "sequence": "MPFLDIQKRFGLNIDRWWTIQSAEQPYKLAPRCHAFEKEWIECAHGIGAIRAEKECKIEYDDFIECLLRQKTMRRVNAIRRQRDKLIKEGKYTPPPHHIGKGEPRP",
        "proteome": "UP000233100",
        "gene": "NDUFS5",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cbabbdcdaf6577109a3f9ac96c973ce95f4665d2",
        "counters": {
            "domain_architectures": 2183,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2183
        }
    }
}