"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4R3M6"	"{'domain_architectures': 2183, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2183}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"NDUFS5"	""	"NDUS5_MACFA"	"cbabbdcdaf6577109a3f9ac96c973ce95f4665d2"	True	False	False	106	"NADH dehydrogenase [ubiquinone] iron-sulfur protein 5"	3	"UP000233100"	"MPFLDIQKRFGLNIDRWWTIQSAEQPYKLAPRCHAFEKEWIECAHGIGAIRAEKECKIEYDDFIECLLRQKTMRRVNAIRRQRDKLIKEGKYTPPPHHIGKGEPRP"	"reviewed"	"{'taxId': '9541', 'scientificName': 'Macaca fascicularis', 'fullName': 'Macaca fascicularis (Crab-eating macaque)'}"