GET /api/protein/UniProt/Q4QYU5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4QYU5",
        "id": "Q4QYU5_SACBR",
        "source_organism": {
            "taxId": "152679",
            "scientificName": "Saccharum barberi",
            "fullName": "Saccharum barberi (Indian sugarcane)"
        },
        "name": "Cytochrome f",
        "description": [
            "Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions"
        ],
        "length": 36,
        "sequence": "RVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF",
        "proteome": null,
        "gene": "petA",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042651",
                "name": "thylakoid membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e3c3bd582c43bf058955d151a1a40c30a665b92",
        "counters": {
            "domain_architectures": 175,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 175
        }
    }
}