"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4QYU5"	"{'domain_architectures': 175, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 175}"	"['Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions']"	"petA"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042651', 'name': 'thylakoid membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"Q4QYU5_SACBR"	"5e3c3bd582c43bf058955d151a1a40c30a665b92"	True	False	True	36	"Cytochrome f"	3	""	"RVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF"	"unreviewed"	"{'taxId': '152679', 'scientificName': 'Saccharum barberi', 'fullName': 'Saccharum barberi (Indian sugarcane)'}"
