GET /api/protein/UniProt/Q4L9Y3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q4L9Y3",
"id": "Q4L9Y3_STAHJ",
"source_organism": {
"taxId": "279808",
"scientificName": "Staphylococcus haemolyticus (strain JCSC1435)",
"fullName": "Staphylococcus haemolyticus (strain JCSC1435)"
},
"name": "Mannitol-specific phosphotransferase enzyme IIA component",
"description": [
"The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II CmtAB PTS system is involved in D-mannitol transport"
],
"length": 144,
"sequence": "MTELFSNDNIFLNVSVGSQDEAIEKAGRALVDNGSVNEAYIQAMKEREQLVSTFMGNGLAIPHGTDEAKGDVLASGLTLLQIPEGVDWNGETVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVNAKSAEEIKQVFEEADA",
"proteome": null,
"gene": "mtlA",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "63916ddc97314a696e2eb523d0b2663c7608f198",
"counters": {
"domain_architectures": 28786,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 28786
}
}
}