GET /api/protein/UniProt/Q4L9Y3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4L9Y3",
        "id": "Q4L9Y3_STAHJ",
        "source_organism": {
            "taxId": "279808",
            "scientificName": "Staphylococcus haemolyticus (strain JCSC1435)",
            "fullName": "Staphylococcus haemolyticus (strain JCSC1435)"
        },
        "name": "Mannitol-specific phosphotransferase enzyme IIA component",
        "description": [
            "The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II CmtAB PTS system is involved in D-mannitol transport"
        ],
        "length": 144,
        "sequence": "MTELFSNDNIFLNVSVGSQDEAIEKAGRALVDNGSVNEAYIQAMKEREQLVSTFMGNGLAIPHGTDEAKGDVLASGLTLLQIPEGVDWNGETVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVNAKSAEEIKQVFEEADA",
        "proteome": null,
        "gene": "mtlA",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "63916ddc97314a696e2eb523d0b2663c7608f198",
        "counters": {
            "domain_architectures": 28786,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28786
        }
    }
}