"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4L9Y3"	"{'domain_architectures': 28786, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'panther': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 28786}"	"['The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II CmtAB PTS system is involved in D-mannitol transport']"	"mtlA"	""	"Q4L9Y3_STAHJ"	"63916ddc97314a696e2eb523d0b2663c7608f198"	True	False	False	144	"Mannitol-specific phosphotransferase enzyme IIA component"	4	""	"MTELFSNDNIFLNVSVGSQDEAIEKAGRALVDNGSVNEAYIQAMKEREQLVSTFMGNGLAIPHGTDEAKGDVLASGLTLLQIPEGVDWNGETVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVNAKSAEEIKQVFEEADA"	"unreviewed"	"{'taxId': '279808', 'scientificName': 'Staphylococcus haemolyticus (strain JCSC1435)', 'fullName': 'Staphylococcus haemolyticus (strain JCSC1435)'}"