GET /api/protein/UniProt/Q4JB30/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4JB30",
        "id": "Q4JB30_SULAC",
        "source_organism": {
            "taxId": "330779",
            "scientificName": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)",
            "fullName": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)"
        },
        "name": "Probable Brix domain-containing ribosomal biogenesis protein",
        "description": [
            "Probably involved in the biogenesis of the ribosome"
        ],
        "length": 199,
        "sequence": "MLPEYGTVENAKQSGQVLLIHPIRVLLTSSRDSSSRIRSFLNELSYIIPDSFKINRGRQSLDDIFKRSRLYGASYIVIVSSSKGNPGRFLVYNTYTSIREFDIKIQGITLLKEIGGRESKIVSKKIRVGCIGELSNTLVKNLFMNLGYTGVENCESYVNGRYIEKINDKNIYEVKFLDAHNNIIGPTIRFLVDEGSNKY",
        "proteome": "UP000001018",
        "gene": "Saci_0607",
        "go_terms": [
            {
                "identifier": "GO:0019843",
                "name": "rRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}