GET /api/protein/UniProt/Q4JB30/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q4JB30",
"id": "Q4JB30_SULAC",
"source_organism": {
"taxId": "330779",
"scientificName": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)",
"fullName": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)"
},
"name": "Probable Brix domain-containing ribosomal biogenesis protein",
"description": [
"Probably involved in the biogenesis of the ribosome"
],
"length": 199,
"sequence": "MLPEYGTVENAKQSGQVLLIHPIRVLLTSSRDSSSRIRSFLNELSYIIPDSFKINRGRQSLDDIFKRSRLYGASYIVIVSSSKGNPGRFLVYNTYTSIREFDIKIQGITLLKEIGGRESKIVSKKIRVGCIGELSNTLVKNLFMNLGYTGVENCESYVNGRYIEKINDKNIYEVKFLDAHNNIIGPTIRFLVDEGSNKY",
"proteome": "UP000001018",
"gene": "Saci_0607",
"go_terms": [
{
"identifier": "GO:0019843",
"name": "rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1
}
}
}