"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4JB30"	"{'domain_architectures': 0, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'smart': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1}"	"['Probably involved in the biogenesis of the ribosome']"	"Saci_0607"	"[{'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q4JB30_SULAC"	""	True	False	False	199	"Probable Brix domain-containing ribosomal biogenesis protein"	3	"UP000001018"	"MLPEYGTVENAKQSGQVLLIHPIRVLLTSSRDSSSRIRSFLNELSYIIPDSFKINRGRQSLDDIFKRSRLYGASYIVIVSSSKGNPGRFLVYNTYTSIREFDIKIQGITLLKEIGGRESKIVSKKIRVGCIGELSNTLVKNLFMNLGYTGVENCESYVNGRYIEKINDKNIYEVKFLDAHNNIIGPTIRFLVDEGSNKY"	"unreviewed"	"{'taxId': '330779', 'scientificName': 'Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)', 'fullName': 'Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)'}"