General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q47LE5",
        "id": "NUOB_THEFY",
        "source_organism": {
            "taxId": "269800",
            "scientificName": "Thermobifida fusca (strain YX)",
            "fullName": "Thermobifida fusca (strain YX)"
        },
        "name": "NADH-quinone oxidoreductase subunit B",
        "description": [
            "NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
        ],
        "length": 185,
        "sequence": "MGLEEKLPSGVLLTTVEQIVGFVRKTSMWPATFGLACCAIEMMAAGGPRFDIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRTIYDQMAEPKWVIAMGVCASSGGMFNNYAIVQGVDHIVPVDIYLPGCPPRPEMLLDAILKLHDKVQNTKLGVHREREIEELEQRRLRALPLIQQTEEATR",
        "proteome": null,
        "gene": "nuoB",
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048038",
                "name": "quinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ec2bdf213efa2e994a9300f4d128e854c4d858c2",
        "counters": {
            "domain_architectures": 44517,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 44517
        }
    }
}