"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q47LE5"	"{'domain_architectures': 44517, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 44517}"	"['NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient']"	"nuoB"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0048038', 'name': 'quinone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NUOB_THEFY"	"ec2bdf213efa2e994a9300f4d128e854c4d858c2"	True	False	False	185	"NADH-quinone oxidoreductase subunit B"	3	""	"MGLEEKLPSGVLLTTVEQIVGFVRKTSMWPATFGLACCAIEMMAAGGPRFDIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRTIYDQMAEPKWVIAMGVCASSGGMFNNYAIVQGVDHIVPVDIYLPGCPPRPEMLLDAILKLHDKVQNTKLGVHREREIEELEQRRLRALPLIQQTEEATR"	"reviewed"	"{'taxId': '269800', 'scientificName': 'Thermobifida fusca (strain YX)', 'fullName': 'Thermobifida fusca (strain YX)'}"