General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3UFA8",
        "id": "Q3UFA8_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Non-selective voltage-gated ion channel VDAC3",
        "description": [
            "Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane. Forms a high-conducting channel with a stable open state and a voltage-induced closure with a mild preference for anions over cations. Involved in male fertility and sperm mitochondrial sheath formation"
        ],
        "length": 75,
        "sequence": "AWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA",
        "proteome": null,
        "gene": "Vdac3",
        "go_terms": [
            {
                "identifier": "GO:0008308",
                "name": "voltage-gated monoatomic anion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0098656",
                "name": "monoatomic anion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005741",
                "name": "mitochondrial outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b61af2137f24347970cf1481b12e2dc4b115f98c",
        "counters": {
            "domain_architectures": 17869,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 17869
        }
    }
}