"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q3UFA8"	"{'domain_architectures': 17869, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 17869}"	"['Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane. Forms a high-conducting channel with a stable open state and a voltage-induced closure with a mild preference for anions over cations. Involved in male fertility and sperm mitochondrial sheath formation']"	"Vdac3"	"[{'identifier': 'GO:0008308', 'name': 'voltage-gated monoatomic anion channel activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0098656', 'name': 'monoatomic anion transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005741', 'name': 'mitochondrial outer membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q3UFA8_MOUSE"	"b61af2137f24347970cf1481b12e2dc4b115f98c"	True	False	True	75	"Non-selective voltage-gated ion channel VDAC3"	2	""	"AWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA"	"unreviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"