General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3SP52",
        "id": "Q3SP52_NITWN",
        "source_organism": {
            "taxId": "323098",
            "scientificName": "Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)",
            "fullName": "Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)"
        },
        "name": "Glutathione-dependent peroxiredoxin",
        "description": [
            "Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides"
        ],
        "length": 161,
        "sequence": "MTIKVGDCLPNATFRIMTEDGVLTKSTDDIFKSKKVALFAVPGAYTGTCHKQHLPSIFASANAIKGKGVNEIAIVSVNDVFVMNAWKRDTDQRNEATFLADGNAEFAKAIDMTFDGSEKGLGIRSKRYSMLVEDGVVKTLNVEDSPGKVEVSGGDKLLGQL",
        "proteome": "UP000002531",
        "gene": "Nwi_2686",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008379",
                "name": "thioredoxin peroxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034599",
                "name": "cellular response to oxidative stress",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bf620472e95c549e5bef1560f4101b9ffe90cbef",
        "counters": {
            "domain_architectures": 60130,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 60130
        }
    }
}