"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q3SP52"	"{'domain_architectures': 60130, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 60130}"	"['Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides']"	"Nwi_2686"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008379', 'name': 'thioredoxin peroxidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0034599', 'name': 'cellular response to oxidative stress', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q3SP52_NITWN"	"bf620472e95c549e5bef1560f4101b9ffe90cbef"	True	False	False	161	"Glutathione-dependent peroxiredoxin"	3	"UP000002531"	"MTIKVGDCLPNATFRIMTEDGVLTKSTDDIFKSKKVALFAVPGAYTGTCHKQHLPSIFASANAIKGKGVNEIAIVSVNDVFVMNAWKRDTDQRNEATFLADGNAEFAKAIDMTFDGSEKGLGIRSKRYSMLVEDGVVKTLNVEDSPGKVEVSGGDKLLGQL"	"unreviewed"	"{'taxId': '323098', 'scientificName': 'Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)', 'fullName': 'Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)'}"