GET /api/protein/UniProt/Q3SP06/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3SP06",
        "id": "Q3SP06_NITWN",
        "source_organism": {
            "taxId": "323098",
            "scientificName": "Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)",
            "fullName": "Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)"
        },
        "name": "Cell division protein ZapA",
        "description": [
            "Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division"
        ],
        "length": 127,
        "sequence": "MSHVNVTINSRQYRMACEDGQEDRLLKLAGDLEGRIGQLRGKFGEIGDQRLEVMAALVTSDELMDAQQRIRALEEELKALRDVRAAAAERARATQTAVVAALNMAAHRIEKTTQVLNRTVGGGIAIG",
        "proteome": "UP000002531",
        "gene": "Nwi_2732",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c53cc3f60b50f86d6eaf925d526da9863fb8c89f",
        "counters": {
            "domain_architectures": 16076,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16076
        }
    }
}