"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q3SP06"	"{'domain_architectures': 16076, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 16076}"	"['Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division']"	"Nwi_2732"	""	"Q3SP06_NITWN"	"c53cc3f60b50f86d6eaf925d526da9863fb8c89f"	True	False	False	127	"Cell division protein ZapA"	4	"UP000002531"	"MSHVNVTINSRQYRMACEDGQEDRLLKLAGDLEGRIGQLRGKFGEIGDQRLEVMAALVTSDELMDAQQRIRALEEELKALRDVRAAAAERARATQTAVVAALNMAAHRIEKTTQVLNRTVGGGIAIG"	"unreviewed"	"{'taxId': '323098', 'scientificName': 'Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)', 'fullName': 'Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)'}"