General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q39EP8",
        "id": "Q39EP8_BURL3",
        "source_organism": {
            "taxId": "482957",
            "scientificName": "Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)",
            "fullName": "Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)"
        },
        "name": "gamma-glutamyl-gamma-aminobutyrate hydrolase",
        "description": [
            "Involved in the breakdown of putrescine via hydrolysis of the gamma-glutamyl linkage of gamma-glutamyl-gamma-aminobutyrate"
        ],
        "length": 268,
        "sequence": "MRARPIVAVTADRILRGAHPNHTAGEKYLAALVDGAGALAFVLPALGARQPADAIVAAIDGLLLTGSYSNVEPHHYGGTASAPDTLHDPARDATALPLIRAAIDAGVPVLAICRGMQELNVAYGGTLHQRLHATTGFDDHRERPADPLERQYGPAHVVQFAPGGLLQRVARGAQAATVNSLHDQGIAQLGAGLVVEASAPDGLVEAVSVRGARAFALGVQWHPEWRYAEQSLSRDIFAAFGAACRARMTHRIHAAGGAMASPAASDVD",
        "proteome": "UP000002705",
        "gene": "Bcep18194_A5474",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016811",
                "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "822d01378a172fd09f0876464bfef9eb4272ec87",
        "counters": {
            "domain_architectures": 22197,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22197
        }
    }
}