"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q39EP8"	"{'domain_architectures': 22197, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'ssf': 1, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22197}"	"['Involved in the breakdown of putrescine via hydrolysis of the gamma-glutamyl linkage of gamma-glutamyl-gamma-aminobutyrate']"	"Bcep18194_A5474"	"[{'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016811', 'name': 'hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q39EP8_BURL3"	"822d01378a172fd09f0876464bfef9eb4272ec87"	True	False	False	268	"gamma-glutamyl-gamma-aminobutyrate hydrolase"	3	"UP000002705"	"MRARPIVAVTADRILRGAHPNHTAGEKYLAALVDGAGALAFVLPALGARQPADAIVAAIDGLLLTGSYSNVEPHHYGGTASAPDTLHDPARDATALPLIRAAIDAGVPVLAICRGMQELNVAYGGTLHQRLHATTGFDDHRERPADPLERQYGPAHVVQFAPGGLLQRVARGAQAATVNSLHDQGIAQLGAGLVVEASAPDGLVEAVSVRGARAFALGVQWHPEWRYAEQSLSRDIFAAFGAACRARMTHRIHAAGGAMASPAASDVD"	"unreviewed"	"{'taxId': '482957', 'scientificName': 'Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)', 'fullName': 'Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)'}"
