HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q31QU5",
"id": "Q31QU5_SYNE7",
"source_organism": {
"taxId": "1140",
"scientificName": "Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)",
"fullName": "Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)"
},
"name": "Lipoyl synthase",
"description": [
"Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives"
],
"length": 297,
"sequence": "MVVKPEWLRVKAPQWQRVGNVKQVLADLGLNTVCEEASCPNIGECFNAGTATFLIMGPACTRACPYCDIDFEKKPKALDPTEPQRLAEAVGRLNLNHVVITSVNRDDLPDGGAEQFKRCIEAVRSRSPQTTIEVLIPDLCGNWEALEIILSAAPEVLNHNIETVSRLYRRVRPQGDYQRSLELLRRSREQAPWIYTKSGLMVGLGETAEEVQQVLVDLRSVDCDIVTIGQYLQPTQKHLGVDRFVTPAEFDAWQQQGSQLGFLQVVASPLTRSSYHAEEVRRLMQEYPRQRPAIALN",
"proteome": "UP000889800",
"gene": "lipA",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016992",
"name": "lipoate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009107",
"name": "lipoate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1d7b556ab52b38ef5d2d40d0fa5e3282ff6cdc48",
"counters": {
"domain_architectures": 140037,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"smart": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"sfld": 3,
"pirsf": 1,
"ncbifam": 3,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140037
}
}
}