"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q31QU5"	"{'domain_architectures': 94905, 'entries': 20, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'smart': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'sfld': 3, 'pirsf': 1, 'panther': 1, 'ncbifam': 3, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 94905}"	"['Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives']"	"lipA"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016992', 'name': 'lipoate synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009107', 'name': 'lipoate biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q31QU5_SYNE7"	"1d7b556ab52b38ef5d2d40d0fa5e3282ff6cdc48"	True	False	297	"Lipoyl synthase"	3	"UP000889800"	"MVVKPEWLRVKAPQWQRVGNVKQVLADLGLNTVCEEASCPNIGECFNAGTATFLIMGPACTRACPYCDIDFEKKPKALDPTEPQRLAEAVGRLNLNHVVITSVNRDDLPDGGAEQFKRCIEAVRSRSPQTTIEVLIPDLCGNWEALEIILSAAPEVLNHNIETVSRLYRRVRPQGDYQRSLELLRRSREQAPWIYTKSGLMVGLGETAEEVQQVLVDLRSVDCDIVTIGQYLQPTQKHLGVDRFVTPAEFDAWQQQGSQLGFLQVVASPLTRSSYHAEEVRRLMQEYPRQRPAIALN"	"unreviewed"	"{'taxId': '1140', 'scientificName': 'Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)', 'fullName': 'Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)'}"
