HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2T5B2",
"id": "Q2T5B2_BURTA",
"source_organism": {
"taxId": "271848",
"scientificName": "Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)",
"fullName": "Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)"
},
"name": "D-alanyl-D-alanine dipeptidase",
"description": [
"Catalyzes hydrolysis of the D-alanyl-D-alanine dipeptide"
],
"length": 189,
"sequence": "MKTPAHRLVEITPRTHGVDVDLAYATDRNLTGKPIYRRTHCLLIEPAEAALRRAVTVAAQIGLRLRIYDAYRPPRAQQVLWDFLPDPAFVADLGRGSNHSRGAALDLTLVDANGVALDMGTGFDDMVAASNHFHDGLPEPVQRNRLLLLGVMHAAGFTHIASEWWHYELPGSRALPLIDGDASGPWRLM",
"proteome": "UP000001930",
"gene": "ddpX",
"go_terms": [
{
"identifier": "GO:0008237",
"name": "metallopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016805",
"name": "dipeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e60685f5e70ccd0552737157196c1f7bcf355740",
"counters": {
"domain_architectures": 7720,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7720
}
}
}