"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2T5B2"	"{'domain_architectures': 7720, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'ncbifam': 1, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7720}"	"['Catalyzes hydrolysis of the D-alanyl-D-alanine dipeptide']"	"ddpX"	"[{'identifier': 'GO:0008237', 'name': 'metallopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016805', 'name': 'dipeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q2T5B2_BURTA"	"e60685f5e70ccd0552737157196c1f7bcf355740"	True	False	False	189	"D-alanyl-D-alanine dipeptidase"	3	"UP000001930"	"MKTPAHRLVEITPRTHGVDVDLAYATDRNLTGKPIYRRTHCLLIEPAEAALRRAVTVAAQIGLRLRIYDAYRPPRAQQVLWDFLPDPAFVADLGRGSNHSRGAALDLTLVDANGVALDMGTGFDDMVAASNHFHDGLPEPVQRNRLLLLGVMHAAGFTHIASEWWHYELPGSRALPLIDGDASGPWRLM"	"unreviewed"	"{'taxId': '271848', 'scientificName': 'Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)', 'fullName': 'Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)'}"