GET /api/protein/UniProt/Q2RQ36/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2RQ36",
        "id": "PHAJ_RHORT",
        "source_organism": {
            "taxId": "269796",
            "scientificName": "Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)",
            "fullName": "Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)"
        },
        "name": "(R)-specific enoyl-CoA hydratase",
        "description": [
            "Catalyzes the hydration of trans-2-enoyl-CoAs with a chain-length of 4-6 carbon atoms, forming the corresponding (3R)-3-hydroxyacyl-CoAs, which can then be utilized for the production of polyhydroxyalkanoates (PHA) polymers. Cannot use trans-2,3-octenoyl-CoA as substrate"
        ],
        "length": 144,
        "sequence": "MSADDLILHYFEDIKEGQSASLAKTISESDIYLFAGLSMDTNPAHVNEDYAQTTVFKTRIAHGMLSAGFISAVLGTRLPGPGAIYVNQSLKFKAPVRIGDTVTATVTVTGLVPEKKFVTFRTTCTVAGKVVIEGEATVMVPARG",
        "proteome": "UP000001929",
        "gene": "phaJ",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "af2c21c37abde4aad8ea5b40d5be705eb46f866c",
        "counters": {
            "domain_architectures": 47141,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 47141
        }
    }
}