"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2RQ36"	"{'domain_architectures': 47141, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 47141}"	"['Catalyzes the hydration of trans-2-enoyl-CoAs with a chain-length of 4-6 carbon atoms, forming the corresponding (3R)-3-hydroxyacyl-CoAs, which can then be utilized for the production of polyhydroxyalkanoates (PHA) polymers. Cannot use trans-2,3-octenoyl-CoA as substrate']"	"phaJ"	""	"PHAJ_RHORT"	"af2c21c37abde4aad8ea5b40d5be705eb46f866c"	True	False	False	144	"(R)-specific enoyl-CoA hydratase"	1	"UP000001929"	"MSADDLILHYFEDIKEGQSASLAKTISESDIYLFAGLSMDTNPAHVNEDYAQTTVFKTRIAHGMLSAGFISAVLGTRLPGPGAIYVNQSLKFKAPVRIGDTVTATVTVTGLVPEKKFVTFRTTCTVAGKVVIEGEATVMVPARG"	"reviewed"	"{'taxId': '269796', 'scientificName': 'Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)', 'fullName': 'Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)'}"