GET /api/protein/UniProt/Q2QLC2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2QLC2",
"id": "CAV2_PLEMO",
"source_organism": {
"taxId": "9523",
"scientificName": "Plecturocebus moloch",
"fullName": "Plecturocebus moloch (Dusky titi monkey)"
},
"name": "Caveolin-2",
"description": [
"May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity)"
],
"length": 162,
"sequence": "MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVVAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSQD",
"proteome": null,
"gene": "CAV2",
"go_terms": [
{
"identifier": "GO:0070836",
"name": "caveola assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "87859599f95b088575091febf3c4794df197c51e",
"counters": {
"domain_architectures": 4184,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4184
}
}
}