General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2QLC2",
        "id": "CAV2_PLEMO",
        "source_organism": {
            "taxId": "9523",
            "scientificName": "Plecturocebus moloch",
            "fullName": "Plecturocebus moloch (Dusky titi monkey)"
        },
        "name": "Caveolin-2",
        "description": [
            "May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity)"
        ],
        "length": 162,
        "sequence": "MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVVAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSQD",
        "proteome": null,
        "gene": "CAV2",
        "go_terms": [
            {
                "identifier": "GO:0070836",
                "name": "caveola assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "87859599f95b088575091febf3c4794df197c51e",
        "counters": {
            "domain_architectures": 4184,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4184
        }
    }
}