"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2QLC2"	"{'domain_architectures': 4184, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4184}"	"['May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity)']"	"CAV2"	"[{'identifier': 'GO:0070836', 'name': 'caveola assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"CAV2_PLEMO"	"87859599f95b088575091febf3c4794df197c51e"	True	False	False	162	"Caveolin-2"	3	""	"MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVVAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSQD"	"reviewed"	"{'taxId': '9523', 'scientificName': 'Plecturocebus moloch', 'fullName': 'Plecturocebus moloch (Dusky titi monkey)'}"