General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2LLU2",
        "id": "Q2LLU2_BPPHX",
        "source_organism": {
            "taxId": "338118",
            "scientificName": "Enterobacteria phage NC11",
            "fullName": "Enterobacteria phage NC11"
        },
        "name": "Internal scaffolding protein B",
        "description": [
            "Participates in the assembly of the viral procapsid in the cytoplasm. Forms first a 12S pre-assembly complex with protein H, and F and G pentamers, then twelve 12S complexes are joined by the D protein to form the procapsid. Internal scaffold protein B is released from the procapsid upon genome packaging. Autoproteolytic activity cleaves protein B and probably facilitates its removal through the pores of the procapsid"
        ],
        "length": 120,
        "sequence": "MEQLTKNQAVATSQEIIQNPNEPQLRDENAHNVQPVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF",
        "proteome": null,
        "gene": "B",
        "go_terms": [
            {
                "identifier": "GO:0019069",
                "name": "viral capsid assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "30bdc1853d6007e6f824ea29a2c3b81205b3e5f2",
        "counters": {
            "domain_architectures": 104,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 104
        }
    }
}