"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2LLU2"	"{'domain_architectures': 104, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 104}"	"['Participates in the assembly of the viral procapsid in the cytoplasm. Forms first a 12S pre-assembly complex with protein H, and F and G pentamers, then twelve 12S complexes are joined by the D protein to form the procapsid. Internal scaffold protein B is released from the procapsid upon genome packaging. Autoproteolytic activity cleaves protein B and probably facilitates its removal through the pores of the procapsid']"	"B"	"[{'identifier': 'GO:0019069', 'name': 'viral capsid assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q2LLU2_BPPHX"	"30bdc1853d6007e6f824ea29a2c3b81205b3e5f2"	False	False	False	120	"Internal scaffolding protein B"	3	""	"MEQLTKNQAVATSQEIIQNPNEPQLRDENAHNVQPVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF"	"unreviewed"	"{'taxId': '338118', 'scientificName': 'Enterobacteria phage NC11', 'fullName': 'Enterobacteria phage NC11'}"