General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q29SP9",
        "id": "Q29SP9_RANAM",
        "source_organism": {
            "taxId": "109177",
            "scientificName": "Rana amurensis",
            "fullName": "Rana amurensis (Siberian wood frog)"
        },
        "name": "ADP/ATP translocase",
        "description": [
            "ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane",
            "Catalyzes the exchange of ADP and ATP across the membrane"
        ],
        "length": 166,
        "sequence": "KEQGFISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLAKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGFAS",
        "proteome": null,
        "gene": "AAT",
        "go_terms": [
            {
                "identifier": "GO:0005471",
                "name": "ATP:ADP antiporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140021",
                "name": "mitochondrial ADP transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1990544",
                "name": "mitochondrial ATP transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005743",
                "name": "mitochondrial inner membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9a514267c6491c9924c6aeac63a5819745aaee5f",
        "counters": {
            "domain_architectures": 29840,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 29840
        }
    }
}