"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q29SP9"	"{'domain_architectures': 29840, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 2, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 29840}"	"['ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane', 'Catalyzes the exchange of ADP and ATP across the membrane']"	"AAT"	"[{'identifier': 'GO:0005471', 'name': 'ATP:ADP antiporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0140021', 'name': 'mitochondrial ADP transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:1990544', 'name': 'mitochondrial ATP transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005743', 'name': 'mitochondrial inner membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q29SP9_RANAM"	"9a514267c6491c9924c6aeac63a5819745aaee5f"	True	False	True	166	"ADP/ATP translocase"	3	""	"KEQGFISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLAKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGFAS"	"unreviewed"	"{'taxId': '109177', 'scientificName': 'Rana amurensis', 'fullName': 'Rana amurensis (Siberian wood frog)'}"
