General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q28066",
        "id": "C4BPB_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "C4b-binding protein beta chain",
        "description": [
            "Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with serum amyloid P component"
        ],
        "length": 198,
        "sequence": "MFFWLMCYLVDVWLISASDVGHCPDPLLVTDEFSSLEPVNVNDTFMFKCNEHCIFKGSNWSQCRENHTRVTHSPVSKSRDCGPPETPTHGYFEGRDFKSGSTITYYCEARYRLVGTQHQQCIDGEWTSAPPICELIQEAPKPAELELEKAFLAFQESKELCKAIKKFTQRLKKSDLTMEKVKYSLERKKAKLKAKMLL",
        "proteome": "UP000009136",
        "gene": "C4BPB",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b92fd36567404641e46ca8e61e3e666d9aaf3929",
        "counters": {
            "domain_architectures": 8032,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8032
        }
    }
}