"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q28066"	"{'domain_architectures': 8032, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'smart': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 8032}"	"['Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with serum amyloid P component']"	"C4BPB"	""	"C4BPB_BOVIN"	"b92fd36567404641e46ca8e61e3e666d9aaf3929"	True	False	False	198	"C4b-binding protein beta chain"	2	"UP000009136"	"MFFWLMCYLVDVWLISASDVGHCPDPLLVTDEFSSLEPVNVNDTFMFKCNEHCIFKGSNWSQCRENHTRVTHSPVSKSRDCGPPETPTHGYFEGRDFKSGSTITYYCEARYRLVGTQHQQCIDGEWTSAPPICELIQEAPKPAELELEKAFLAFQESKELCKAIKKFTQRLKKSDLTMEKVKYSLERKKAKLKAKMLL"	"reviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"