GET /api/protein/UniProt/Q27J47/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q27J47",
        "id": "VSPPA_LACMU",
        "source_organism": {
            "taxId": "8753",
            "scientificName": "Lachesis muta muta",
            "fullName": "Lachesis muta muta (Bushmaster)"
        },
        "name": "Venom plasminogen activator LV-PA",
        "description": [
            "Snake venom serine protease that activates plasminogen. Weakly hydrolyzes the alpha chain of human fibrinogen without releasing fibrinopeptide A. Does not hydrolyze plasma kallikrein or factor Xa. Does not clot fibrinogen. Does not affect platelet function. Induces hypotensive effects on rats. Shows a preferential cleavage at Lys-|-Xaa over Arg-|-Xaa bonds"
        ],
        "length": 258,
        "sequence": "MVLITVLANLLILQLSYAQKSSKLVFGGDECNINEHRSLVVLFNSSGFLCAGTLINKEWVLTAAHCDSENFQMQLGVHSKKVPNKDEETRDPKEKFICPNRKKNDEKDKDIMLIRLNRPVSNSEHIALLSLPSSPPSVGSVCRIMGWGTISPTKEIYPDVPHCADINILDHAVCRAAYSGWLATSTTLCAGILEGGKDSCHGDSGGPLICNGQFQGIVSLGRHPCGHPDEPGVYTKVFDYTDWIQSIIAGNTDAACPP",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004252",
                "name": "serine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9eb5193692395549c59ea14a515b8bb2c75cc329",
        "counters": {
            "domain_architectures": 140214,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 140214
        }
    }
}